polishfoodies.comPolish Foodies | Authentic Polish Food Recipes

polishfoodies.com Profile

polishfoodies.com is a domain that was created on 2019-11-25,making it 4 years ago. It has several subdomains, such as shop.polishfoodies.com , among others.

Description:Discover authentic polish cuisine. Try these authentic Polish recipes written by a native...

Discover polishfoodies.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

polishfoodies.com Information

HomePage size: 630.55 KB
Page Load Time: 0.404962 Seconds
Website IP Address: 162.159.137.54

polishfoodies.com Similar Website

MexGrocer.com Blog – Latest News on Mexican Food, Grocery Brands, Authentic Recipes and Culture from
blog.mexgrocer.com
Home - Polish Foodies
shop.polishfoodies.com
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
Food and Fitness, Healthy Recipes, Food Safety | UNL Food | University of Nebraska–Lincoln
food.unl.edu
Christine's Recipes: Easy Chinese Recipes | Delicious Recipes
en.christinesrecipes.com
Food News, Health News, Indian Recipes, Healthy Recipes, Vegetarian Recipes, Indian Food recipes – N
food.ndtv.com
Recipes & Cookbooks - Food, Cooking Recipes - BettyCrocker.com
origin-www.bettycrocker.com
Safe Food, Fair Food | Safe Food, Fair Food in Africa
safefoodfairfood.ilri.org
Food Science Conference | Food Tech Webinars, Food Science Online Meetings, Food Technology 2020, Fo
foodtech.madridge.com
CIA Foodies - Experience the World of Food with Culinary Institute of America
enthusiasts.ciachef.edu
For The Love of Food Recipes: Delicious FREE recipes for your enjoyment! - Powered by Maian Recipe v
recipes.fortheloveoffood.org
Love Of Food: Easy Recipes, Popular Recipes and Video Cooking Tips
inmykitchen.sodexo.com
Polish Slavic Center - HOME - Polish Slavic Center New York
en.polishslaviccenter.us
Cibo Matto Blog - Local and Organic Food | Local and Organic Food, Authentic Italian Cooking and
blog.cibomattocaffe.com
Polish Home Association Gallery – A visual history of the Polish Home Association, other
gallery.polishhome.org

polishfoodies.com PopUrls

Polish Foodies | Authentic Polish Food Recipes
https://polishfoodies.com/
Polish Foodies: Home
https://shop.polishfoodies.com/
About
https://polishfoodies.com/about/
Pantry
https://polishfoodies.com/pantry/
Blog
https://polishfoodies.com/blog/
Contact
https://polishfoodies.com/contact/
Videos
https://polishfoodies.com/videos/
What Is The Polish Tea? The Most Popular Teas In Poland.
https://polishfoodies.com/polish-tea/
Christmas Cookbook
https://polishfoodies.com/christmas-cookbook/
Authentic Gołąbki - Polish Stuffed Cabbage Rolls Recipe!
https://polishfoodies.com/authentic-polish-golumpki-recipe/
My Grandma's Pierogi Ruskie Recipe That Tastes Like Poland - Polish Foodies
https://polishfoodies.com/polish-pierogi-ruskie-recipe/
Traditional Polish Meat Pierogi Recipe [Pierogi z Mięsem] - Polish Foodies
https://polishfoodies.com/polish-meat-pierogi-recipe/
Authentic Polish Bigos Recipe [VIdeo+Tips For Cooking]
https://polishfoodies.com/polish-bigos-recipe/
Kotlety Mielone Recipe - Traditional Polish Ground Pork Cutlets
https://polishfoodies.com/polish-kotlety-mielone-recipe/
Pierogi Leniwe Polish Lazy Pierogi Recipe - Polish Foodies
https://polishfoodies.com/pierogi-leniwe-lazy-pierogi-recipe/

polishfoodies.com DNS

A polishfoodies.com. 300 IN A 162.159.136.54
MX polishfoodies.com. 3600 IN MX 1 aspmx.l.google.com.
NS polishfoodies.com. 21600 IN NS karl.ns.cloudflare.com.
TXT polishfoodies.com. 300 IN TXT ca3-390652bda46e4f518e219547f18145b2
SOA polishfoodies.com. 1800 IN SOA karl.ns.cloudflare.com. dns.cloudflare.com. 2341242083 10000 2400 604800 1800

polishfoodies.com Httpheader

Date: Sat, 11 May 2024 23:20:02 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
CF-Ray: 8825e5b9f88a7d89-LAX
CF-Cache-Status: HIT
Age: 20999
Cache-Control: max-age=0, s-maxage=2592000
Expires: Sat, 11 May 2024 16:51:05 GMT
Last-Modified: Sat, 11 May 2024 16:51:07 GMT
Link: https://polishfoodies.com/wp-json/; rel="https://api.w.org/", https://polishfoodies.com/wp-json/wp/v2/pages/6915; rel="alternate"; type="application/json"
Vary: Accept-Encoding
cf-edge-cache: cache,platform=wordpress
content-security-policy: block-all-mixed-content
Server: cloudflare
alt-svc: h3=":443"; ma=86400

polishfoodies.com Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1" name="viewport"/
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots"
content="Discover authentic polish cuisine. Try these authentic Polish recipes written by a native Pole." name="description"
content="en_US" property="og:locale"/
content="website" property="og:type"/
content="Polish Foodies | Authentic Polish Food Recipes" property="og:title"/
content="Discover authentic polish cuisine. Try these authentic Polish recipes written by a native Pole." property="og:description"/
content="https://polishfoodies.com/" property="og:url"/
content="Polish Foodies" property="og:site_name"/
content="https://www.facebook.com/polishfoodies/" property="article:publisher"/
content="2024-03-25T11:58:23+00:00" property="article:modified_time"/
content="https://polishfoodies.com/wp-content/uploads/2021/04/Authentic-Polish-pierogi-making-Karolina.jpg" property="og:image"/
content="1" property="og:image:width"/
content="1" property="og:image:height"/
content="image/jpeg" property="og:image:type"/
content="summary_large_image" name="twitter:card"/
content="@karolinapatryk" name="twitter:site"/
content="51bc7462fb2a980ac2a08f28f80e049c" name="msvalidate.01"/
content="oCm30lguS4x2AMIqgf75dwqnfKtfpk2h4MtXoEP81YM" name="google-site-verification"/
content="Site Kit by Google 1.126.0" name="generator"/
content="Elementor 3.21.5; features: e_optimized_assets_loading, e_optimized_css_loading, e_font_icon_svg, additional_custom_breakpoints; settings: css_print_method-external, google_font-enabled, font_display-swap" name="generator"/
content="https://polishfoodies.com/wp-content/uploads/2021/09/cropped-Sygnet-Polish-Foodies-v3-270x270.png" name="msapplication-TileImage"

polishfoodies.com Html To Plain Text

Cookbooks Dinner Beef Chicken Fish Pork Soups Veal Venison Diet Type Dairy-Free Gluten-Free Healthy Keto Low Carb High Fat Vegan Vegetarian Side dishes Preserves Salads Sauces Drinks Alcohol-Free Drinks Polish Alcoholic Drinks Pierogi Dessert Cookies Cakes Easter Travel Poland Cookbooks Dinner Beef Chicken Fish Pork Soups Veal Venison Diet Type Dairy-Free Gluten-Free Healthy Keto Low Carb High Fat Vegan Vegetarian Side dishes Preserves Salads Sauces Drinks Alcohol-Free Drinks Polish Alcoholic Drinks Pierogi Dessert Cookies Cakes Easter Travel Poland Search Search Close this search box. Discover authentic, diverse Polish cuisine. Grandma’s recipes written by a native Pole. See All Recipes Cookbooks Dinner Beef Chicken Fish Pork Soups Veal Venison Diet Type Dairy-Free Gluten-Free Healthy Keto Low Carb High Fat Vegan Vegetarian Side dishes Preserves Salads Sauces Drinks Alcohol-Free Drinks Polish Alcoholic Drinks Pierogi Dessert Cookies Cakes Easter Travel Poland Cookbooks Dinner Beef Chicken Fish Pork Soups Veal Venison Diet Type Dairy-Free Gluten-Free Healthy Keto Low Carb High Fat Vegan Vegetarian Side dishes Preserves Salads Sauces Drinks Alcohol-Free Drinks Polish Alcoholic Drinks Pierogi Dessert Cookies Cakes Easter Travel Poland POLISH FOODIES COOKBOOKS: Polish Foodies Cookbook See Details Polish Christmas Cookbook See Details Polish Cakes & Desserts Cookbook See Details Polish Easter Cookbook See Details Polish Soups Cookbook See Details Polish Breakfast Cookbook See Details Polish Fat Thursday (Tuesday) Cookbook See Details Polish Romantic Dinner mini-Cookbook See Details Join the Polish Foodies Community! Join 88,000+ Polish Foodies who are sharing their favorite Polish recipes on our Facebook group every day! Join Us Search Search featured Authentic Polish Golumpki Recipe – Stuffed Cabbage Rolls That Taste Like Poland! My Grandma’s Pierogi Ruskie Recipe Babka Pomarańczowa Polish Orange Bundt Cake Recipe Traditional Polish Easter Food (With Recipes) Reviews & Testimonials Hello Karolina, Unfortunately my Matka and Babcia never taught us the language...specially how to write the language. I want to thank you for my cookbooks that arrived today. I cannot wait to share with my brother and my cousin. All three of us love Polish food and at least recognize the names of dishes. LOL. Thank you again. I wish you and yours the best. Timothy Carney (Wisniewski) US I got the 5 cookbooks today. Just in time to mail them to my family for Christmas. It looks really good. Can’t wait to sit down and read it. They came so fast I couldn’t believe it. I’m going to send one or two of my mom’s recipes along with the book along with a little family history. Paula S New Jersey, USA I found your blog less than a year ago. My grandparents didn’t write down many recipes, so I’m excited to try them. I’m lucky I live in a city that has two authentic Polish markets and one restaurant. It will be nice to cook more Polish food at home. Pam Adamski United States Polish Foodies recipes are amazing and so accurate, the long lost recipes that weren’t handed down you can find here. So good, try the Perogi recipe, it doesn’t disappoint. Ann Nana Muszynski United States Thank you for setting up this website! I appreciate all of your hard work. You are such a wonderful connection to my Polish roots. You are doing so much good in the world. My heart aches for my deceased mom and grandma (Polish). I don’t get to spend time with them now, but you have provided me with an outlet to practice my Polish heritage. I thank you from the bottom of my heart. I love the fellowship that you have provided through your site. Also, my priest is Polish and with your recipes, I am able to give authentic Polish food to him! Hugs to you Karolina. Merry Christmas and a very Happy New Year to you. Kathryn Smersh USA This website has helped me in staying connected with my roots though cooking thank you Karolina Helen Gnap Montreal, Canada Karolina, I must say, I think what you are doing is fantastic. While I know I’m not 100% polish, I grew up with a very polish grandfather who also spoke fluent polish. I learned a few words, but they were the not so nice ones, lol. Every holiday we had a huge spread of all the traditional favorites. Everything from perogies to kielbasa. My husband’s family is Italian, and he had tried and didn’t care for either of those until he came to a Christmas dinner with my family. My grandmother made 5 different perogie fillings along with her kielbasa and sour krout with apples. He doesn’t like sour krout, but I couldn’t keep him out of it. I don’t like it by itself, but if my grandmother makes it with the kielbasa and apples, and it cooks in the crock pot all day, YUM! I love reading your emails, I will be looking forward to ? Day! My aunt and I get together or video chat and celebrate both dates! (Gives us a good excuse to splurge on the sweets!) Thank you again, Ginger E. USA I am an American and my mom was Polish. Her mother became ill when my mom was 10 some missed her formative years of being with her mom in the kitchen. For some reason her cousins Margaret and Deloris suffered the same fate so none of my family matriarchal chain knew much about cooking. They would talk about their babcia’s cooking and the food they keen as children, but they purchased it from local grocers. It was important to me that our daughter know her family history and food so your blog and pinterest site have meant the world to me. Now if I could just find the recipe for the roast pork served at all our family weddings! Thank you Suzanne M. Cline (Pashak) USA Dear Karolina, I read your recipes quite often but I remember many that have been passed on to me by my mother. She was not the best cook since we were taken to Germany as slave laborers and my parents had to work for a German farmer. We come from Wolyn, Poland and when I was six years old, we were taken to Germany. We experienced hunger and cold. My parents were forced to work on a German farm where my father died of overwork. My mother became a widow with 4 children in a strange country and strange language. We were liberated in 1945 and my mother remarried. In 1949. When I was 12 years old, we were able to immigrate to the United States. We grew and worked hard and prospered. During World War 2, there was very little food available but mother remembered all the wonderful recipes that she had learned from her mother when she was a young woman. So pierogi, nalesniki, placki kartoflane were one of her favorites and this knowledge was passed on to me and my sisters when we were young women. To this day, we cook our wonderful Polish food. and observe Wigilia at Christmas time as well as Lent during Easter. So this is my story and I just wanted to share it with you dear Karolino.I enjoy making your recipes as they may be a bit different from the ones that I have made. Helen Z. USA Hello Karolina I enjoy the contents of your communications. I was born in Chicago on the south side in 1949. I am Lithuanian on my Father’s side and Sicilian on my Mother’s side. Our families were great cooks. My Father made perogies and other Polish delicacies, so very delicious. There was a Polish Restaurant on the Indiana border called Warsaws, they had the best smorgasbords. I read recently where they have now closed after a run of over 50 years. What I miss about those times is how food was a community glue. We had many Polish friends and the nationalities all blended well. Sharing recipes and meals which took us all back to our origins; how I miss those times. Now I am in Phoenix area and try to enjoy a Polish meal as often as I can. Your love of your culture shows, don’t think you are not making a difference. We not only hunger for the food but the memories which you have awakened. Thank you Margi P. USA Recipes on Polish Foodie’s has brought back priceless cherished childhood memories of Polish foods like my mother and Cioci made! I...

polishfoodies.com Whois

Domain Name: POLISHFOODIES.COM Registry Domain ID: 2459447874_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.cloudflare.com Registrar URL: http://www.cloudflare.com Updated Date: 2023-10-26T19:57:49Z Creation Date: 2019-11-25T11:40:19Z Registry Expiry Date: 2024-11-25T11:40:19Z Registrar: CloudFlare, Inc. Registrar IANA ID: 1910 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: KARL.NS.CLOUDFLARE.COM Name Server: LIV.NS.CLOUDFLARE.COM DNSSEC: signedDelegation DNSSEC DS Data: 2371 13 2 ADB392CEA432DC050FC4B58D02E55E1BBC6AE8887D5BBEB6A5B8D92808D5242A >>> Last update of whois database: 2024-05-17T14:18:59Z <<<